Loading...
Statistics
Advertisement

RGB Support Desk
www.rgbsupport.co.uk/

Rgbsupport.co.uk

Advertisement
Conversion Technology Metas Server
Rgbsupport.co.uk is hosted in United Kingdom . Rgbsupport.co.uk uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Php, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Rgbsupport.co.uk

Technology

Number of occurences: 3
  • CSS
  • Html
  • Php

Advertisement

Server Type

  • Apache

Powered by

  • PHP/5.6.21

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Rgbsupport.co.uk

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HOSTING SERVICES, INC./OU=PositiveSSL/CN=cpanel31.uk2.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HOSTING SERVICES, INC.
        • 2: PositiveSSL
      • CN: cpanel31.uk2.net
    • hash: dab7b171
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 97775757122251724129381977988543186575
    • validFrom: 160223000000Z
    • validTo: 170222235959Z
    • validFrom_time_t: 1456185600
    • validTo_time_t: 1487807999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: F8:F2:02:BC:1D:80:4E:E5:2B:0C:60:66:10:4F:29:2D:B4:6E:5C:28
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:cpanel31.uk2.net, DNS:www.cpanel31.uk2.net

Meta - Rgbsupport.co.uk

Number of occurences: 1
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 83.170.79.102
  • Latitude: 51.50
  • Longitude: -0.12
  • Country: United Kingdom

Rname

  • ns-uk.1and1-dns.co.uk
  • ns-uk.1and1-dns.com
  • ns-uk.1and1-dns.org
  • ns-uk.1and1-dns.biz
  • mx01.1and1.co.uk
  • mx00.1and1.co.uk

Target

  • hostmaster.1and1.com

HTTP Header Response

HTTP/1.1 200 OK Date: Fri, 20 May 2016 18:14:45 GMT Server: Apache X-Powered-By: PHP/5.6.21 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=ba6ebfd20c2e827686be4b6be33b37fb; path=/ Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

DNS

host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 83.170.79.102
host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-uk.1and1-dns.co.uk
host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-uk.1and1-dns.com
host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-uk.1and1-dns.org
host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns-uk.1and1-dns.biz
host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns-uk.1and1-dns.co.uk
  5. rname: hostmaster.1and1.com
  6. serial: 2014112501
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mx01.1and1.co.uk
host: rgbsupport.co.uk
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mx00.1and1.co.uk

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.gbsupport.co.uk, www.rigbsupport.co.uk, www.igbsupport.co.uk, www.rogbsupport.co.uk, www.ogbsupport.co.uk, www.rlgbsupport.co.uk, www.lgbsupport.co.uk, www.rlgbsupport.co.uk, www.lgbsupport.co.uk, www.r.gbsupport.co.uk, www..gbsupport.co.uk, www.rbsupport.co.uk, www.rgsbsupport.co.uk, www.rsbsupport.co.uk, www.rgxbsupport.co.uk, www.rxbsupport.co.uk, www.rgybsupport.co.uk, www.rybsupport.co.uk, www.rghbsupport.co.uk, www.rhbsupport.co.uk, www.rgnbsupport.co.uk, www.rnbsupport.co.uk, www.rgcbsupport.co.uk, www.rcbsupport.co.uk, www.rgdbsupport.co.uk, www.rdbsupport.co.uk, www.rgebsupport.co.uk, www.rebsupport.co.uk, www.rgrbsupport.co.uk, www.rrbsupport.co.uk, www.rgtbsupport.co.uk, www.rtbsupport.co.uk, www.rgbbsupport.co.uk, www.rbbsupport.co.uk, www.rgvbsupport.co.uk, www.rvbsupport.co.uk, www.rgsupport.co.uk, www.rgbqsupport.co.uk, www.rgqsupport.co.uk, www.rgbwsupport.co.uk, www.rgwsupport.co.uk, www.rgbzsupport.co.uk, www.rgzsupport.co.uk, www.rgbxsupport.co.uk, www.rgxsupport.co.uk, www.rgbsupport.co.uk, www.rgsupport.co.uk, www.rgbssupport.co.uk, www.rgssupport.co.uk, www.rgbysupport.co.uk, www.rgysupport.co.uk, www.rgbesupport.co.uk, www.rgesupport.co.uk, www.rgbdsupport.co.uk, www.rgdsupport.co.uk, www.rgbcsupport.co.uk, www.rgcsupport.co.uk, www.rgbupport.co.uk, www.rgbseupport.co.uk, www.rgbeupport.co.uk, www.rgbswupport.co.uk, www.rgbwupport.co.uk, www.rgbsdupport.co.uk, www.rgbdupport.co.uk, www.rgbsxupport.co.uk, www.rgbxupport.co.uk, www.rgbsfupport.co.uk, www.rgbfupport.co.uk, www.rgbsgupport.co.uk, www.rgbgupport.co.uk, www.rgbstupport.co.uk, www.rgbtupport.co.uk, www.rgbspport.co.uk, www.rgbsuwpport.co.uk, www.rgbswpport.co.uk, www.rgbsuepport.co.uk, www.rgbsepport.co.uk, www.rgbsuspport.co.uk, www.rgbsspport.co.uk, www.rgbsuapport.co.uk, www.rgbsapport.co.uk, www.rgbsuport.co.uk, www.rgbsupiport.co.uk, www.rgbsuiport.co.uk, www.rgbsupkport.co.uk, www.rgbsukport.co.uk, www.rgbsupuport.co.uk, www.rgbsuuport.co.uk, www.rgbsupjport.co.uk, www.rgbsujport.co.uk, www.rgbsuplport.co.uk, www.rgbsulport.co.uk, www.rgbsuport.co.uk, www.rgbsuppiort.co.uk, www.rgbsupiort.co.uk, www.rgbsuppkort.co.uk, www.rgbsupkort.co.uk, www.rgbsuppuort.co.uk, www.rgbsupuort.co.uk, www.rgbsuppjort.co.uk, www.rgbsupjort.co.uk, www.rgbsupplort.co.uk, www.rgbsuplort.co.uk, www.rgbsupprt.co.uk, www.rgbsuppobrt.co.uk, www.rgbsuppbrt.co.uk, www.rgbsuppohrt.co.uk, www.rgbsupphrt.co.uk, www.rgbsuppogrt.co.uk, www.rgbsuppgrt.co.uk, www.rgbsuppojrt.co.uk, www.rgbsuppjrt.co.uk, www.rgbsuppomrt.co.uk, www.rgbsuppmrt.co.uk, www.rgbsuppo rt.co.uk, www.rgbsupp rt.co.uk, www.rgbsuppovrt.co.uk, www.rgbsuppvrt.co.uk, www.rgbsuppot.co.uk, www.rgbsupporit.co.uk, www.rgbsuppoit.co.uk, www.rgbsupporot.co.uk, www.rgbsuppoot.co.uk, www.rgbsupporlt.co.uk, www.rgbsuppolt.co.uk, www.rgbsupporlt.co.uk, www.rgbsuppolt.co.uk, www.rgbsuppor.t.co.uk, www.rgbsuppo.t.co.uk, www.rgbsuppor.co.uk, www.rgbsupportq.co.uk, www.rgbsupporq.co.uk, www.rgbsupporta.co.uk, www.rgbsuppora.co.uk, www.rgbsupport .co.uk, www.rgbsuppor .co.uk, www.rgbsupportw.co.uk, www.rgbsupporw.co.uk, www.rgbsupporte.co.uk, www.rgbsuppore.co.uk, www.rgbsupportz.co.uk, www.rgbsupporz.co.uk, www.rgbsupportx.co.uk, www.rgbsupporx.co.uk, www.rgbsupportc.co.uk, www.rgbsupporc.co.uk,

Other websites we recently analyzed

  1. AWAY REALTY | Лучшее агентство зарубежной недвижимости
    HOMES.RU - AWAY REALTY: Элитная зарубежная недвижимость, элитная недвижимость за рубежом, продажа домов за рубежом, квартира, апартаменты, вилла, пентхаус, коттедж, таунхаус, особняк, дача, бунгало, офис, земля, земельный участок, страны мира, Европа, острова, экзотика, правовая информация, визы, описание страны по недвижимости, Австрия, Великобритания, Германия, Испания, Италия, Португалия, Франция, Хорватия, Черногория.
    Netherlands - 109.206.190.54
    Server software: nginx/1.10.1
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Yandex.Metrika
    Number of Javascript: 4
    Number of meta tags: 5
  2. Soltows Gaststätte und Partyservice | Essen außer Haus | Veranstaltungen
    Informationen zu Soltows Gaststätte und Partyservice
    Germany - 95.130.250.70
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 12
  3. Welcome to BESTRESTAURANTSINKEYWEST.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  4. OUTROXTREME
    Korea, Republic of - 183.111.174.8
    Server software: nginx
    Technology: CSS, Html
    Number of meta tags: 1
  5. Leonardo Almeida | Sposen Realty & Development
    San Antonio (United States) - 67.192.7.83
    Server software: Apache
    Technology: Maxcdn, OSS CDN, CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, jQuery Validate, jQuery UI, Php, Pingback, Wordpress
    Number of Javascript: 38
    Number of meta tags: 3
  6. 63355.xyz
    San Jose (United States) - 23.27.192.115
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. virgingalacticspaceflightsystems.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  8. cheaplouboutinsssstores.com
    Switzerland - 141.8.225.181
    Server software: nginx/1.9.2
    Technology: Html
  9. ITAIM KEIKO - Longevidade no Esporte Tênis de Mesa
    Academia de Tênis de Mesa Especializada
    Houston (United States) - 192.185.217.48
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 12
    Number of meta tags: 5
  10. petalumahomesonline.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites